mCherry-SH3(5R)
(Plasmid
#112154)
-
PurposeMammalian expression plasmid for SH3-5R in a vector expressing mCherry.
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 112154 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepmCherry-N1
-
Backbone manufacturerClontech
- Backbone size w/o insert (bp) 4700
- Total vector size (bp) 5906
-
Modifications to backboneunknown if there are any modifications to backbone. size is an estimate
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameSH3-5R
-
Alt name5 repeats of second SH3 domain of Nck1 (Nck adaptor protein 1)
-
SpeciesH. sapiens (human)
-
Insert Size (bp)1208
-
Mutationonly the second SH3 domain is expressed in this construct
-
GenBank IDNM_001190796.2
-
Entrez GeneNCK1 (a.k.a. NCK, NCKalpha, nck-1)
- Promoter CMV
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site EcoRI (not destroyed)
- 3′ cloning site BamHI (not destroyed)
- 5′ sequencing primer EGFP-N Sequencing Primer (CMV forward primer): 5'-CGCAAATGGGCGGTAGGCGTG-3'
- 3′ sequencing primer mCherry-R: 5'-TTGGTCACCTTCAGCTTGG-3' (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
protein sequence:
HMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATHMDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLASGAGGSEGGGSEGGTSGATDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKSSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGRDPPVAT (-mCherry)
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
mCherry-SH3(5R) was a gift from Michael Rosen (Addgene plasmid # 112154 ; http://n2t.net/addgene:112154 ; RRID:Addgene_112154) -
For your References section:
Phase transitions in the assembly of multivalent signalling proteins. Li P, Banjade S, Cheng HC, Kim S, Chen B, Guo L, Llaguno M, Hollingsworth JV, King DS, Banani SF, Russo PS, Jiang QX, Nixon BT, Rosen MK. Nature. 2012 Mar 7;483(7389):336-40. doi: 10.1038/nature10879. 10.1038/nature10879 PubMed 22398450