|
Plasmid
12795:
DCT.VV.Orf107
|
Addgene has sequenced a portion of this plasmid for verification. Click here for the sequencing result. Please acknowledge the principal investigator and cite this article if you use this plasmid in a publication. Also, please include the text "Addgene plasmid 12795" in your Materials and Methods section. |
Vaccinia Virus ORF library, ORF 107
Protein sequence: mtmkmmvhiyfvslllllfhsyaidieneite ffnkmrdtlpakdskwlnpacmfggtmndiaa lgepfsakcppiedsllshrykdyvvkwerle knrrrqvsnkrvkhgdlwianytskfsnrryl ctvttkngdcvqgivrshirkppscipktyel gthdkygidlycgilyakhynnitwykdnkei niddikysqtgkeliihnpeledsgrydcyvh yddvrikndivvsrckiltvipsqdhrfklil dpkinvtigepanitctavstslliddvliew enpsgwligfdfdvysvltsrggiteatlyfe nvteeyigntykcrghnyyfektltttvvle
Additional reference: see McCraith et al, PNAS 2000
97:4879-4884. Genome-wide analysis of vaccinia virus protein-protein
interactions.