Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFLCQYCAQRFGRKDHLTRHMKKSH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 34. ToolGen ZF Name: RDHR1.
Addgene has sequenced a portion of this plasmid for verification.
Click here for the sequencing
result.
Please acknowledge the principal investigator and cite this article if you use
this plasmid in a publication. Also, please include the text "Addgene plasmid
13181" in your Materials and Methods section.
Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFLCQYCAQRFGRKDHLTRHMKKSH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 34. ToolGen ZF Name: RDHR1.