1
Plasmid 13181: pc3XB-ZF131
  • ZF131

  • 90

  • pc3XB
    (Search Vector Database)

  • Modified Invitrogen pcDNA3

  • Mammalian Expression

  • 5400

  • XbaI

  • No

  • BamHI

  • No

  • T7 List of Sequencing Primers

  • Ampicillin

  • XL1 Blue

  • 37

  • High Copy

  • Neomycin

  • View sequences (2)
  • Keith Joung

  • UBMTA
    Sangamo Zinc-Finger Agreement

Comments: 

Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFLCQYCAQRFGRKDHLTRHMKKSH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 34. ToolGen ZF Name: RDHR1.

Addgene has sequenced a portion of this plasmid for verification. Click here for the sequencing result.

Please acknowledge the principal investigator and cite this article if you use this plasmid in a publication. Also, please include the text "Addgene plasmid 13181" in your Materials and Methods section.

Price: US $65

Available to academic and non-profits only