pc3XB-ZF131
(Plasmid #13181)

Available to Academic and Nonprofits Only

Backbone

  • Vector backbone
    pc3XB
  • Backbone manufacturer
    Modified Invitrogen pcDNA3
  • Backbone size w/o insert (bp) 5400
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    XL1 Blue
  • Copy number
    High Copy

Sequence Information

Gene/Insert

  • Gene/Insert name
    ZF131
  • Insert Size (bp)
    90

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site XbaI (not destroyed)
  • 3′ cloning site BamHI (not destroyed)
  • 5′ sequencing primer T7
  • (Common Sequencing Primers)

Resource Information

Depositor Comments

Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFLCQYCAQRFGRKDHLTRHMKKSH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 34. ToolGen ZF Name: RDHR1.

How to cite this plasmid

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pc3XB-ZF131 was a gift from Keith Joung (Addgene plasmid # 13181)