1
Plasmid 13181: pc3XB-ZF131
  • ZF131

  • 90

  • pc3XB
    (Search Vector Database)

  • Modified Invitrogen pcDNA3

  • Mammalian Expression

  • 5400

  • XbaI

  • No

  • BamHI

  • No

  • T7 List of Sequencing Primers

  • Ampicillin

  • XL1 Blue

  • 37

  • High Copy

  • Neomycin

  • View sequences (2)
  • Keith Joung

  • UBMTA
    Sangamo Zinc-Finger Agreement

Comments: 

Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFLCQYCAQRFGRKDHLTRHMKKSH. Target DNA sequence: GGG. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 34. ToolGen ZF Name: RDHR1.

Addgene has sequenced a portion of this plasmid for verification. Full plasmid sequence is available only if provided by the depositing laboratory.

Please acknowledge the principal investigator and cite this article if you use this plasmid in a publication. Also, please include the text "Addgene plasmid 13181" in your Materials and Methods section.

Price: US $65

Available to academic and non-profits only