Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF10
(Plasmid #162819)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 162819 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pAS
  • Vector type
    Mammalian Expression ; PiggyBac

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    NEB Stable
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Ub-(N-TAG)CoV2_ORF10
  • Species
    SARS-CoV-2
  • Mutation
    CoV2_ORF10(Met1,Amber)
  • Promoter EF1alpha

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Unknown (unknown if destroyed)

Terms and Licenses

Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Protein sequence: (TAG)GYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF10 was a gift from Simon Elsaesser (Addgene plasmid # 162819 ; http://n2t.net/addgene:162819 ; RRID:Addgene_162819)
  • For your References section:

    Universal Single-Residue Terminal Labels for Fluorescent Live Cell Imaging of Microproteins. Lafranchi L, Schlesinger D, Kimler KJ, Elsasser SJ. J Am Chem Soc. 2020 Nov 25;142(47):20080-20087. doi: 10.1021/jacs.0c09574. Epub 2020 Nov 11. 10.1021/jacs.0c09574 PubMed 33175524