L3MBTL3 (3UT1)
(Plasmid
#36901)
-
PurposeBacterial expression for structure determination; may not be full ORF
-
Depositing Lab
-
Publication
-
Sequence Information
Full plasmid sequence is not available for this item.
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 36901 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepET28-SBP-TEV
-
Backbone manufacturerSGC (Addgene plasmid 36943)
- Backbone size w/o insert (bp) 7445
- Total vector size (bp) 8414
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert nameL3MBTL3
-
Alt namePDB: 3UT1
-
Alt nameLethal(3)malignant brain tumor-like protein 3, 3 MBT repeats
-
SpeciesH. sapiens (human)
-
Insert Size (bp)969
-
Mutationcontains amino acid residues 228-551 only
-
GenBank IDBC060845
-
Entrez GeneL3MBTL3 (a.k.a. MBT-1, MBT1)
-
Tags
/ Fusion Proteins
- His tag (N terminal on backbone)
- Streptavidin-Binding Peptide (SBP)-Tag with TEV cleavage (N terminal on insert)
Cloning Information
- Cloning method Ligation Independent Cloning
- 5′ sequencing primer T7
- 3′ sequencing primer T7-term (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
PDB: 3UT1. http://www.thesgc.org/structures/3UT1/
N-terminal tag: MHHHHHHEFMDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPSSGRENLYFQG
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
L3MBTL3 (3UT1) was a gift from Cheryl Arrowsmith (Addgene plasmid # 36901 ; http://n2t.net/addgene:36901 ; RRID:Addgene_36901)