pC-FLAG-ZCD2
(Plasmid #79274)

• Purpose: Mammalian expression of ZCD2 with a C-terminal FLAG tag
• Depositing Lab: Rita Shiang
• Publication: Amr et al Am J Hum Genet. 2007 Oct;81(4):673-83. Epub 2007 Aug 20.

Backbone

• Vector backbone: pDEST26-C-FLAG
• Backbone size w/o insert (bp): 7500
• Vector type: Mammalian Expression
• Selectable markers: Neomycin (select with G418)

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: ZCD2
• Species: H. sapiens (human)
• Entrez Gene: CISD2 (a.k.a. ERIS, Miner1, NAF-1, WFS2, ZCD2)
• Promoter: CMV
• Tag / Fusion Protein:
  • FLAG (C terminal on backbone)

Cloning Information

• Cloning method: Gateway Cloning
• 5′ sequencing primer: CMV-F
• 3′ sequencing primer: M13-F20

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Industry MTA

Depositor Comments

Please note that the amino acid sequence LKEPIQSTGSGTEFPGYRRPTRPGSGEEWTPLAR is inserted before the start of the ZCD2 sequence. The depositor noted that this sequence does NOT affect plasmid function.