Skip to main content

Anti-TARPGamma2/Stargazin [N245/1R]
(Antibody #184199)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 184199-rAb 100 µg of purified recombinant antibody $262 *
Recombinant Antibody trial size 184199-rAb.T 20 µg of purified recombinant antibody $89 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-TARPGamma2/Stargazin [N245/1R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2909566

Terms and Licenses

Target Antigen

Protein Voltage-dependent calcium channel gamma-2 subunit
Antigen Description Amino acids 203–323 (cytoplasmic C-terminus) of rat TARPGamma2
Antigen Amino Acid Sequence
DRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV
Species R. norvegicus (rat)
Additional Species Reactivity M. musculus (mouse)
Gene Cacng2
Alternative Names
  • Neuronal voltage-gated calcium channel gamma-2 subunit
  • Stargazin
  • Transmembrane AMPAR regulatory protein gamma-2
  • TARP gamma-2
External References

Applications (1)

Clear filters

Western Blot

1 image
Western Blot image by Susumu Tomita, Yale University
Submitted By: Susumu Tomita, Yale University
Antibody Type
Hybridoma
Target Species
M. musculus (mouse)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-TARPGamma2/Stargazin [N245/1R] - from James Trimmer (Addgene antibody # 184199 ; http://n2t.net/addgene:184199 ; RRID:AB_2909566)
  • For your References section:

    High-volume hybridoma sequencing on the NeuroMabSeq platform enables efficient generation of recombinant monoclonal antibodies and scFvs for neuroscience research. Mitchell KG, Gong B, Hunter SS, Burkart-Waco D, Gavira-O'Neill CE, Templeton KM, Goethel ME, Bzymek M, MacNiven LM, Murray KD, Settles ML, Froenicke L, Trimmer JS. Sci Rep. 2023 Sep 27;13(1):16200. doi: 10.1038/s41598-023-43233-4. 10.1038/s41598-023-43233-4 PubMed 37758930