HiBiT-MCHR2 Fusion Vector
(Plasmid
#258998)
-
PurposeExpress N-terminally tagged HiBiT-fusion protein in mammalian cells under a CMV promoter, with IL-6 secretion signal peptide at the N-terminus for trafficking the fusion protein to plasma membrane.
-
Depositing Lab
-
Depositing OrganizationPromega Corporation
Located in the United States of America -
Publication
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 258998 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $94 * | |
* Log in to view industry pricing.
Backbone
-
Vector backbonepFN39K secHiBiT CMV-neo Flexi Vector
-
Vector typeMammalian Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameMCHR2
-
Alt namemelanin concentrating hormone receptor 2(MCHR2)
-
Alt nameATG4136
-
SpeciesH. sapiens (human)
-
Entrez GeneMCHR2 (a.k.a. GPR145, GPRv17, MCH-2R, MCH-R2, MCH2, MCH2R, MCHR-2, SLT)
-
Tags
/ Fusion Proteins
- MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVSVSGWRLFKKISGSSGGSSGAIA (N terminal on insert)
- C-terminal valine (PmeI cloning artifact) (C terminal on insert)
Cloning Information
- Cloning method Other
Resource Information
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
Trademarks:
- Zeocin® is an InvivoGen trademark.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
HiBiT-MCHR2 Fusion Vector was a gift from Promega Corporation (Addgene plasmid # 258998)