-
Depositing Lab
-
Depositing OrganizationUniversity of Massachusetts, Amherst
Located in the United States of America -
Citations
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 32749 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $94 | |
| DNA | 32749-D50 | 50 μg of DNA in Tris buffer | $495 | ||
| DNA | 32749-D100 | 100 μg of DNA in Tris buffer | $585 | ||
Backbone
-
Vector backbonepT-CD8-IRES-SCN2B
-
Backbone manufacturerDr. Alfred George, Vanderbilt University
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert 1
-
Gene/Insert nameCA-GFP
-
Insert Size (bp)854
-
MutationS65T
- Promoter CMV
Cloning Information for Gene/Insert 1
- Cloning method Restriction Enzyme
- 5′ cloning site NheI (not destroyed)
- 3′ cloning site EcoRI (not destroyed)
- 5′ sequencing primer CMV-F
- 3′ sequencing primer IRES-R
- (Common Sequencing Primers)
Gene/Insert 2
-
Gene/Insert namemLumin
-
Alt namemKate2-S158A
-
Insert Size (bp)700
-
MutationS158A
Cloning Information for Gene/Insert 2
- Cloning method Restriction Enzyme
- 5′ cloning site SalI (not destroyed)
- 3′ cloning site NotI (not destroyed)
- 5′ sequencing primer IRES-F
- (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
CA-GFP sequence is GFP fused with DEVDFQGPCNDSSDPLVVAASIIGILHLILWILDRL at the C-terminus
DNA (Catalog # 32749-D50)
Purpose
Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.
Delivery
- Amount 50 μg
- Concentration 1 μg/μL
- Pricing $495 USD
- Storage 4 ℃ (short-term) or -20 ℃ (long-term)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Quality Control
Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.
Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.
DNA (Catalog # 32749-D100)
Purpose
Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.
Delivery
- Amount 100 μg
- Concentration 1 μg/μL
- Pricing $585 USD
- Storage 4 ℃ (short-term) or -20 ℃ (long-term)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Quality Control
Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.
Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pT-CA-GFP-IRES-mLumin was a gift from Jeanne Hardy (Addgene plasmid # 32749 ; http://n2t.net/addgene:32749 ; RRID:Addgene_32749) -
For your References section:
Mechanism of a genetically encoded dark-to-bright reporter for caspase activity. Nicholls SB, Chu J, Abbruzzese G, Tremblay KD, Hardy JA. J Biol Chem. 2011 Jul 15;286(28):24977-86. Epub 2011 May 10. 10.1074/jbc.M111.221648 PubMed 21558267