Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

ppil2.280.457.Y389W
(Plasmid #137657)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 137657 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pET28a-LIC
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Low Copy

Gene/Insert

  • Gene/Insert name
    ppil2
  • Species
    H. sapiens (human)
  • Mutation
    280-457-Y389W
  • Entrez Gene
    PPIL2 (a.k.a. CYC4, CYP60, Cyp-60, UBOX7, hCyP-60)
  • Tag / Fusion Protein
    • (His)6-thrombin (N terminal on backbone)

Cloning Information

  • Cloning method Ligation Independent Cloning
  • 5′ sequencing primer T7F and LIC primer: gtttcgctcctgtgcctggctggacaagaagcatac
  • 3′ sequencing primer T7R and LIC primer: gtatgcttcttgtccagccaggcacaggagcgaaac
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

MGSSHHHHHHSSGLVPRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAWLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    ppil2.280.457.Y389W was a gift from Tara Davis & Melissa Jurica (Addgene plasmid # 137657 ; http://n2t.net/addgene:137657 ; RRID:Addgene_137657)
  • For your References section:

    Structural and biochemical characterization of the human cyclophilin family of peptidyl-prolyl isomerases. Davis TL, Walker JR, Campagna-Slater V, Finerty PJ, Paramanathan R, Bernstein G, MacKenzie F, Tempel W, Ouyang H, Lee WH, Eisenmesser EZ, Dhe-Paganon S. PLoS Biol. 2010 Jul 27;8(7):e1000439. doi: 10.1371/journal.pbio.1000439. 10.1371/journal.pbio.1000439 PubMed 20676357