This website uses cookies to ensure you get the best experience. By continuing the use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected] Learn more

pET21b-LOV-ipaA L514K L531E
(Plasmid #40253)

Loading...

Full plasmid sequence is not available for this item.

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 40253 Plasmid sent as bacteria in agar stab 1 $65

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pET-21b(+)
  • Backbone manufacturer
    EMD Biosciences
  • Backbone size w/o insert (bp) 5442
  • Total vector size (bp) 5939
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    LOV-ipaA L514K L531E
  • Alt name
    Light-sensitive LOV2 domain of Avena Sativa phototropin 1(AsLov2)/Shigella invasin protein ipaA vinculin binding peptide chimera
  • Alt name
    AsLOV2 (aa 404-546)
  • Alt name
    ipaA (aa 610-631)
  • Species
    Synthetic; Avena sativa/Shigella flexneri
  • Insert Size (bp)
    497
  • Mutation
    L514K; L531E; Jα helix region hybridized (AsLOV2 aa 537-546/ipaA aa 610-619), residue 540 changed to isoleucine
  • GenBank ID
    AAC05083.1 AAP78988.1
  • Promoter T7
  • Tag / Fusion Protein
    • 6xHis (N terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site NdeI (not destroyed)
  • 3′ cloning site XhoI (not destroyed)
  • 5′ sequencing primer T7 promoter
  • 3′ sequencing primer T7 terminator
  • (Common Sequencing Primers)

Resource Information

Depositor Comments

This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide. It contains a set of mutations, L514K L531E, that increases the dynamic range of the switch. These mutations replace two hydrophobic residues, one in the Jα helix, and the other on the β sheet contacting the Jα helix, with a salt bridge. This design stabilizes interactions between the β-sheet and Ja helix and leads to a more tightly bound helix in the dark state. This set of mutations makes LOV-ipaA a photoswitch with a 49-fold difference between the lit- and dark-state effector binding affinities.

Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain β-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine.

The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector. All mutations were performed using site-directed mutagenesis.

Protein coding sequence of LOV-ipaA L514K L531E:
MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQKDGTEHVRDAAEREGVMEIKKTANNIIKAAKDVTTSLSKVLKNIN

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pET21b-LOV-ipaA L514K L531E was a gift from Brian Kuhlman (Addgene plasmid # 40253)
  • For your References section:

    Designing photoswitchable peptides using the AsLOV2 domain. Lungu OI, Hallett RA, Choi EJ, Aiken MJ, Hahn KM, Kuhlman B. Chem Biol. 2012 Apr 20;19(4):507-17. 10.1016/j.chembiol.2012.02.006 PubMed 22520757