pET28-At_PRORP1-His
(Plasmid
#67869)
-
Purposebacterial expression of PRORP1 (At2g32230), full coding sequence (mitoch./chloropl. form) + C-term. His tag
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 67869 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepET28-b(+)
-
Backbone manufacturerNovagen
- Backbone size w/o insert (bp) 5369
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert namePRORP1
-
Alt nameAt2g32230
-
SpeciesA. thaliana (mustard weed)
-
Insert Size (bp)1611
-
MutationResidues 36-572 (see comments)
-
GenBank ID817782
-
Entrez GenePRORP1 (a.k.a. AT2G32230, F22D22.2, F22D22_2, proteinaceous RNase P 1)
- Promoter T7
-
Tag
/ Fusion Protein
- His (C terminal on backbone)
Cloning Information
- Cloning method Unknown
- 5′ sequencing primer T7
- 3′ sequencing primer T7 Terminal (Common Sequencing Primers)
Resource Information
-
Supplemental Documents
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
The mitochondrial targeting sequence “MLRLTCFTPSFSRACCPLFAMMLKVPSVHLHHPRF“ of native precursor PRORP1 was replaced with the dipeptide “MG”
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pET28-At_PRORP1-His was a gift from Walter Rossmanith (Addgene plasmid # 67869 ; http://n2t.net/addgene:67869 ; RRID:Addgene_67869) -
For your References section:
tRNA processing by protein-only versus RNA-based RNase P: kinetic analysis reveals mechanistic differences. Pavlova LV, Gossringer M, Weber C, Buzet A, Rossmanith W, Hartmann RK. Chembiochem. 2012 Oct 15;13(15):2270-6. doi: 10.1002/cbic.201200434. Epub 2012 Sep 13. 10.1002/cbic.201200434 PubMed 22976545