Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected] Learn more

(Plasmid #84603)


Item Catalog # Description Quantity Price (USD)
Plasmid 84603 Standard format: Plasmid sent in bacteria as agar stab 1 $75

This material is available to academics and nonprofits only.


Growth in Bacteria

  • Bacterial Resistance(s)
  • Growth Temperature
  • Growth Strain(s)
  • Copy number


  • Gene/Insert name
  • Species
  • Promoter 8xGliBS-delta-crystallin minimal promoter
  • Tag / Fusion Protein
    • ODC1 destabilizing element (C terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site XhoI (not destroyed)
  • 3′ cloning site EcoRI (not destroyed)
  • 5′ sequencing primer pBluescript-SK
  • 3′ sequencing primer unknown
  • (Common Sequencing Primers)

Resource Information

Depositor Comments

The amino acid sequence of the Odc1-derived destabilizing element is: SHGFPPAVAAQDDGTLPMSCAQESGMDRHPAACASARINV.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    8xGliBS-IVS2-mCherry-NLS-Odc1-polyA-Tol2 was a gift from James Chen (Addgene plasmid # 84603 ; ; RRID:Addgene_84603)
  • For your References section:

    In vivo imaging of Hedgehog pathway activation with a nuclear fluorescent reporter. Mich JK, Payumo AY, Rack PG, Chen JK. PLoS One. 2014 Jul 28;9(7):e103661. doi: 10.1371/journal.pone.0103661. eCollection 2014. PONE-D-14-13224 [pii] PubMed 25068273