Skip to main content
Addgene
Open Menu

pCMV6-G1-ATP6-Myc-FLAG (puromycin)
(Plasmid #86851)

Print

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 86851 Standard format: Plasmid sent in bacteria as agar stab 1 $94
Add to Cart
DNA 86851-D50 50 μg of DNA in Tris buffer $495
Add to Cart
DNA 86851-D100 100 μg of DNA in Tris buffer $585
Add to Cart

Backbone

  • Vector backbone
    pCMV6
  • Vector type
    Mammalian Expression
  • Selectable markers
    Puromycin

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    ATP6
  • Species
    H. sapiens (human)
  • Mutation
    codon corrected
  • Entrez Gene
    ATP6 (a.k.a. ATPase6, MTATP6)
  • Promoter CMV
  • Tags / Fusion Proteins
    • ATP5G1 (G1) (MQTAGALFISPALIRCCTRGLIRPVSASFLNS PVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTA) (N terminal on insert)
    • myc (C terminal on backbone)
    • FLAG (C terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site MluI (unknown if destroyed)
  • 3′ cloning site XhoI (unknown if destroyed)
  • 5′ sequencing primer CMV-F
  • 3′ sequencing primer M13-Rev
  • (Common Sequencing Primers)

Resource Information

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Trademarks:

  • Zeocin® is an InvivoGen trademark.

Purpose

Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.

Delivery

  • Amount 50 μg
  • Concentration 1 μg/μL
  • Pricing $495 USD
  • Storage 4 ℃ (short-term) or -20 ℃ (long-term)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Quality Control

Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.

Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.

Purpose

Ready-to-use, high-purity DNA prep. DNA aliquots are suitable for use in mammalian cell transfections and other molecular biology applications.

Delivery

  • Amount 100 μg
  • Concentration 1 μg/μL
  • Pricing $585 USD
  • Storage 4 ℃ (short-term) or -20 ℃ (long-term)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Quality Control

Every DNA prep is verified by next-generation sequencing, confirming plasmid identity, sequence integrity, and absence of DNA contaminants. Concentration is confirmed to be within ±2.5% of the stated concentration.

Our production process has been validated to consistently yield endotoxin levels below 1.0 EU/μg. Individual lots are not tested for endotoxin.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pCMV6-G1-ATP6-Myc-FLAG (puromycin) was a gift from Matthew O'Connor (Addgene plasmid # 86851 ; http://n2t.net/addgene:86851 ; RRID:Addgene_86851)

  • For your References section:

    Stable nuclear expression of ATP8 and ATP6 genes rescues a mtDNA Complex V null mutant. Boominathan A, Vanhoozer S, Basisty N, Powers K, Crampton AL, Wang X, Friedricks N, Schilling B, Brand MD, O'Connor MS. Nucleic Acids Res. 2016 Nov 2;44(19):9342-9357. Epub 2016 Sep 4. 10.1093/nar/gkw756 PubMed 27596602
Related items:
Commonly requested with: