1
Plasmid 12780: DCT.VV.Orf92
  • B1R

  • protein kinase

  • 903

  • Vaccinia Virus

  • 9791130

  • pcDNA 3.1D V5-His-TOPO
    (Search Vector Database)

  • Invitrogen

  • Mammalian Expression

  • 5514

  • BamHI

  • No

  • BamHI

  • No

  • Universal T7 List of Sequencing Primers

  • Ampicillin

  • DH5alpha

  • 37

  • High Copy

  • Neomycin

  • View sequences (1)
  • Jack Bennink

  • Jon Yewdell

  • UBMTA

Comments: 

Vaccinia Virus ORF library, ORF 92

MW (kDa): 34.3. Time of expression: early. From McCraith et al: "essential, protein kinase, virion protein , ts: C2, C3, C25, P: SFV H2R, H: various protein kinases". Forward primer: ATGAACTTTCAAGGACTTGTGTTAA. Reverse primer: TTAATAATATACACCCTGCATTAATATGTG.

Protein sequence: mnfqglvltdncknqwvvgpligkggfgsiyt tndnnyvvkiepkangslfteqafytrvlkps vieewkkshnikhvglitckafglyksinvey rflvinrlgadldavirannnrlpkrsvmlig ieilntiqfmheqgyshgdikasnivldqidk nklylvdyglvskfmsngehvpfirnpnkmdn gtleftpidshkgyvvsrrgdletlgycmirw lggilpwtkisetkncalvsatkqkyvnntat llmtslqyaprellqyitmvnsltyfeepnyd efrhilmqgvyy

Additional reference: see McCraith et al, PNAS 2000
97:4879-4884. Genome-wide analysis of vaccinia virus protein-protein
interactions.

Addgene has sequenced a portion of this plasmid for verification. Full plasmid sequence is available only if provided by the depositing laboratory.

Article: Identification of poxvirus CD8+ T cell determinants to enable rational design and characterization of smallpox vaccines. Tscharke et al (J Exp Med. 2005 January 3; 201(1): 95–104. PubMed)

Please acknowledge the principal investigator and cite this article if you use this plasmid in a publication. Also, please include the text "Addgene plasmid 12780" in your Materials and Methods section.

Price: US $65

Available to academic and non-profits only