Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at help@addgene.org. Learn more

DCT.VV.Orf92
(Plasmid #12780)

Loading...
Add to Cart
Available to Academic and Nonprofits Only

Backbone

  • Vector backbone
    pcDNA 3.1D V5-His-TOPO
  • Backbone manufacturer
    Invitrogen
  • Backbone size w/o insert (bp) 5514
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Sequence Information

Full plasmid sequence is available only if provided by the depositing laboratory.

Gene/Insert

  • Gene/Insert name
    B1R
  • Alt name
    protein kinase
  • Species
    Vaccinia Virus
  • Insert Size (bp)
    903
  • GenBank ID
    9791130

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site BamHI (not destroyed)
  • 3′ cloning site BamHI (not destroyed)
  • 5′ sequencing primer Universal T7
  • (Common Sequencing Primers)

Resource Information

  • Terms and Licenses

Depositor Comments

Vaccinia Virus ORF library, ORF 92

MW (kDa): 34.3. Time of expression: early. From McCraith et al: "essential, protein kinase, virion protein , ts: C2, C3, C25, P: SFV H2R, H: various protein kinases". Forward primer: ATGAACTTTCAAGGACTTGTGTTAA. Reverse primer: TTAATAATATACACCCTGCATTAATATGTG.

Protein sequence: mnfqglvltdncknqwvvgpligkggfgsiyt tndnnyvvkiepkangslfteqafytrvlkps vieewkkshnikhvglitckafglyksinvey rflvinrlgadldavirannnrlpkrsvmlig ieilntiqfmheqgyshgdikasnivldqidk nklylvdyglvskfmsngehvpfirnpnkmdn gtleftpidshkgyvvsrrgdletlgycmirw lggilpwtkisetkncalvsatkqkyvnntat llmtslqyaprellqyitmvnsltyfeepnyd efrhilmqgvyy

Additional reference: see McCraith et al, PNAS 2000
97:4879-4884. Genome-wide analysis of vaccinia virus protein-protein
interactions.

How to cite this plasmid

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    DCT.VV.Orf92 was a gift from Jack Bennink & Jon Yewdell (Addgene plasmid # 12780)
  • For your References section:

    Identification of poxvirus CD8+ T cell determinants to enable rational design and characterization of smallpox vaccines. Tscharke DC, Karupiah G, Zhou J, Palmore T, Irvine KR, Haeryfar SM, Williams S, Sidney J, Sette A, Bennink JR, Yewdell JW. J Exp Med. 2005 January 3; 201(1): 95–104. 10.1084/jem.20041912 PubMed 15623576