-
Depositing Lab
-
Publication
-
Sequence Information
Full plasmid sequence is not available for this item.
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 18004 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepCMV-Tag2B
-
Backbone manufacturerStratagene
- Backbone size w/o insert (bp) 4300
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameER targeted Bcl-2
-
Alt nameBcl-2 Cb5
-
Alt nameBcl2 Cytochrome b5
-
SpeciesH. sapiens (human)
-
Insert Size (bp)761
-
MutationC terminal of Bcl-2 replaced with Cytochrome b5. Targets Bcl-2 to the Endoplasmic Reticulum.
-
Entrez GeneBCL2 (a.k.a. Bcl-2, PPP1R50)
- Promoter CMV
-
Tag
/ Fusion Protein
- Flag (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site unknown (unknown if destroyed)
- 3′ cloning site unknown (unknown if destroyed)
- 5′ sequencing primer T3
- 3′ sequencing primer T7 (Common Sequencing Primers)
Resource Information
-
A portion of this plasmid was derived from a plasmid made byPCR amplified human Bcl-2 from pB4 plasmid purchased from ATCC. PCR amplified Cb5 from EST purchased from ATCC.
-
Articles Citing this Plasmid
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Amino acids 100–134 (ITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED) human cytochrome b5 replaced the C-terminal domain of Bcl-2 (amino acids 219-239).
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
Flag-Bcl2-Cb5 was a gift from Clark Distelhorst (Addgene plasmid # 18004 ; http://n2t.net/addgene:18004 ; RRID:Addgene_18004) -
For your References section:
Transient expression of wild-type or mitochondrially targeted Bcl-2 induces apoptosis, whereas transient expression of endoplasmic reticulum-targeted Bcl-2 is protective against Bax-induced cell death. Wang NS, Unkila MT, Reineks EZ, Distelhorst CW. J Biol Chem. 2001 Nov 23. 276(47):44117-28. 10.1074/jbc.M101958200 PubMed 11546793