Anti-GluA1/GluR1 glutamate receptor [N355/1R]
(Antibody #180093)

• Purpose: Anti-GluA1/GluR1 glutamate receptor (Rat) recombinant mouse monoclonal antibody
• Depositing Lab: James Trimmer
• Publication: Andrews et al Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322.
  
• Recommended Applications: Immunohistochemistry, Western Blot

Features

• Source Species: M. musculus (mouse)
• Isotype: IgG2a
• Light Chain Type: kappa
• Amino Acid Sequences:
  Sequences (2) — Accept Affinity Reagent Sequence Policy

Production & Usage

• Production Plasmid: Anti-GluA1/GluR1 glutamate receptor [N355/1R]
• Purification: Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
• Storage Buffer: PBS + 1 mM sodium azide

Delivery

• Concentration: 0.9–1.1 mg/mL
• Storage: Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
• Shipment: Shipped at room temperature or on blue ice.

Resource Information

• Persistent Resource Identifier: RRID:AB_2750785

Terms and Licenses

• Academic/Nonprofit Terms:
  • Research Use Only Terms
• Industry Terms:
  • Research Use Only Terms

Target Antigen

Protein	Glutamate receptor 1
Antigen Description	Amino acids 1–389 (extracellular N-terminus) of rat GluA1/GluR1
Antigen Amino Acid Sequence	MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFV View Entire Sequence
Species	R. norvegicus (rat)
Additional Species Reactivity	M. musculus (mouse)
Gene	Gria1
Alternative Names	AMPA-selective glutamate receptor 1 GluR-A GluR-K1 Glutamate receptor ionotropic AMPA 1 GluA1
External References	Uniprot ID: P19490

Applications (6)

Assay

All Assay Types

• Immunohistochemistry
• Western Blot

Sample Species

All Sample Species

• M. musculus (mouse)
• R. norvegicus (rat)
• Other

Result

Pass

Information

Application Information

×

Quality Control

Each lot of antibody undergoes testing, either in-house or through outside labs, to confirm recognition of the expected target or to confirm expected labeling across a tissue panel in one of the antibody’s recommended applications. The specific experiments performed varies for each antibody catalog item. Whenever possible, the experiment is performed in parallel with a previous lot of recombinant antibody or the hybridoma-derived equivalent to ensure potency and specificity have been retained.

Learn more: Antibody Production

Recommended Applications

These recommendations are based on a thorough review of experiments performed at Addgene or at outside labs. Addgene has partnered with outside labs in order to provide careful testing of our antibodies in applications that we are not able to test at our own facilities. Addgene works carefully with these trusted partner labs to ensure that experiments include proper controls and sufficient experimental details and these labs are denoted below with an “Addgene Partner” badge. Please note that we show results for applications that work well with our antibody (Recommended) as well as those that do not (Not recommended) so be sure to check the result!

Antibody Type

Many of Addgene’s recombinant antibodies encode sequences that were originally derived from hybridoma lines. In many cases, we provide results from assays performed with this hybridoma-derived antibody in addition to results from assays performed with the recombinant antibody. To prevent confusion, the application data represented on Addgene’s website clearly notes whether the hybridoma material or recombinant antibody material were used in the assay. In some cases, Recommended Applications are based on results from experiments performed with a hybridoma-derived antibody. If you have any trouble with the recombinant antibody for this same application please contact us at .

Immunohistochemistry

Recommended

1 image

Lab: : Zhuhao Wu, Weill Cornell Medicine Addgene Partner

Antibody Type : Recombinant

Sample Species : M. musculus (mouse)

Result : Pass

View Details

Image 1 (of 1): Delipidated mouse brain tissue was stained with Anti-GluA1/GluR1 glutamate receptor [N355/1R].
Credit: Zhuhao Wu, Weill Cornell Medicine

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Immunohistochemistry

Lab:: Zhuhao Wu, Weill Cornell Medicine Addgene Partner

Antibody Type

Recombinant

Antibody Concentration

1 µg/mL

Sample Species

M. musculus (mouse)

Sample Type

70 µm mounted sagittal section

Result

Pass

Details

Tissue type: 70 µm mounted sagittal section

Species: Mouse

Fixative: Paraformaldehyde

Antigen-retrieval: No

Delipidation: Yes

Blocking: B1n (2% w/v glycine, 0.1% v/v Triton-X-100, 0.008% v/v sodium azide in 0.001N sodium hyrdoxide), 3x 1 hour, room temperature

Primary antibody: 1 µg/mL in PTxwH (0.1% v/v Triton-X-100, 0.05% v/v Tween-20, 0.002 mg/mL Heparin, 0.02% sodium azide in PBS), overnight, room temperature

Secondary antibody: HRP-conjugated AffiniPure Goat Anti-Mouse IgG, Fc_ subclass 2a specific (Jackson Labs 115-035-206)

Wu lab thick-section immunohistochemistry protocols

Copy link to share

1 image

Lab: : James Trimmer, UC Davis Addgene Partner

Antibody Type : Recombinant

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Image 1 (of 1): Free-floating rat brain sections were fixed and stained with purified Anti-GluA1/GluR1 glutamate receptor [N355/1R] or hybridoma-derived tissue culture supernatant. The staining patterns from antibody produced at Addgene (AR0018) were compared to UC Davis-derived antibody (TC Supernatant).

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Immunohistochemistry

Lab:: James Trimmer, UC Davis Addgene Partner

Antibody Type

Recombinant

Antibody Concentration

1 µg/mL

Sample Species

R. norvegicus (rat)

Sample Type

Brain

Result

Pass

Details

Tissue type: Free-floating brain sections

Species: Rat

Fixative: Paraformaldehyde

Antigen-retrieval: No

Permeabilization: PBS containing 1:2000 avidin and 0.5% Triton X-100, 45 min, room temperature

Blocking: 0.5% serum, 45 min, room temperature

Primary antibody: 1 µg/mL in PBS, overnight, 4 °C

Secondary antibody: 0.5 µg/mL mix of biotinylated goat anti-mouse IgG1 (Jackson Labs 115-065-205) + goat anti-mouse IgG2a (Jackson Labs 115-065-206) + goat anti-mouse IgG2b (Jackson Labs 115-065-207) in 0.5% serum, 1 hour, room temperature

Trimmer lab immunohistochemistry protocol

Copy link to share

1 image

Lab: : UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Image 1 (of 1): Adult rat hippocampus immunohistochemistry

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Immunohistochemistry

Lab:: UC Davis/NIH NeuroMab Facility

Antibody Type

Hybridoma

Antibody Concentration

Not known

Sample Species

R. norvegicus (rat)

Sample Type

Hippocampus

Result

Pass

Details

NeuroMab hybridoma clone datasheet

Copy link to share

Western Blot

Recommended

1 image

Lab: : James Trimmer, UC Davis Addgene Partner

Antibody Type : Recombinant

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Image 1 (of 1): Crude rat membranes immunoblotted against Anti-GluA1/GluR1 glutamate receptor hybridoma-derived antibody from the Trimmer Lab at UC Davis (H) or purified recombinant antibody produced at Addgene (R).
Credit: James Trimmer, UC Davis

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Western Blot

Lab:: James Trimmer, UC Davis Addgene Partner

Antibody Type

Recombinant

Antibody Concentration

2 µg/mL

Sample Species

R. norvegicus (rat)

Sample Type

Brain

Result

Pass

Details

Total rat brain extract was reduced and separated by denaturing SDS-PAGE

Blocking conditions: 4% non-fat dry milk in TBS pH 7.5, 45 min, room temperature

Primary antibody: 2 µg/mL in 4% non-fat dry milk in TBS pH 7.5, 45 min, room temperature

Secondary antibody: Mix of Jackson Labs HRP-conjugated goat anti-mouse IgG1 + goat anti-mouse IgG2a + goat anti-mouse IgG2b diluted to 1:8333 in 4% non-fat dry milk in TBS pH 7.5, 45 min, room temperature

Predicted molecular weight: 100 kDa

Trimmer lab immunoblot labeling protocol

Copy link to share

1 image

Lab: : UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : Other

Result : Pass

View Details

Image 1 (of 1): Transfected cell immunoblot: extracts of COS cells transiently transfected with untagged GluR1, GluR2 or Kv2.1 plasmid and probed with N355/1 (left), L21/32 (middle) or N52A/42 (right) TC supe.

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Western Blot

Lab:: UC Davis/NIH NeuroMab Facility

Antibody Type

Hybridoma

Antibody Concentration

Not known

Sample Species

Other

Sample Type

Primate - COS

Result

Pass

Details

NeuroMab hybridoma clone datasheet

Copy link to share

1 image

Lab: : UC Davis/NIH NeuroMab Facility

Antibody Type : Hybridoma

Sample Species : R. norvegicus (rat)

Result : Pass

View Details

Image 1 (of 1): Adult rat brain membrane immunoblot

×

Anti-GluA1/GluR1 glutamate receptor [N355/1R]

(Antibody #180093)

Western Blot

Lab:: UC Davis/NIH NeuroMab Facility

Antibody Type

Hybridoma

Antibody Concentration

Not known

Sample Species

R. norvegicus (rat)

Sample Type

Brain

Result

Pass

Details

NeuroMab hybridoma clone datasheet

Copy link to share