HiBiT-F2RL1 Fusion Vector
(Plasmid #259030)

• Purpose: Express N-terminally tagged HiBiT-fusion protein in mammalian cells under a CMV promoter, with IL-6 secretion signal peptide at the N-terminus for trafficking the fusion protein to plasma membrane.
• Depositing Lab: Promega Corporation
• Depositing Organization: Promega Corporation
  Located in the United States of America
• Publication: Promega Plasmid Collection (unpublished)

Backbone

• Vector backbone: pFN39K secHiBiT CMV-neo Flexi Vector
• Vector type: Mammalian Expression

Growth in Bacteria

• Bacterial Resistance(s): Kanamycin, 50 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: High Copy

Gene/Insert

• Gene/Insert name: F2RL1
• Alt name: F2R like trypsin receptor 1(F2RL1)
• Alt name: ATG4140
• Species: H. sapiens (human)
• Mutation: N-terminal signal peptide removed (aa 1-25: MRSPSAAWLLGAAILLAASLSCSGT)
• Entrez Gene: F2RL1 (a.k.a. GPR11, PAR2)
• Tags / Fusion Proteins:
  • MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVSVSGWRLFKKISGSSGGSSGAIA (N terminal on insert)
  • C-terminal valine (PmeI cloning artifact) (C terminal on insert)

Cloning Information

• Cloning method: Other

Terms and Licenses

• Academic/Nonprofit Terms:
  • Research Use Only Terms (Nonprofits)
  • NanoBiT® Luciferase Limited Use Label License
• Industry Terms:
  • Research Use Only Terms (Industry)
  • NanoBiT® Luciferase Limited Use Label License