Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected] Learn more

CMV500 A-CREB
(Plasmid #33371)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 33371 Standard format: Plasmid sent in bacteria as agar stab 1 $75

This material is available to academics and nonprofits only.

Backbone

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    CREB
  • Alt name
    Acidic cAMP Response Element Binding Protein
  • Alt name
    A-CREB
  • Species
    M. musculus (mouse)
  • Mutation
    Dominant Negative (see notes)
  • GenBank ID
    NM_133828
  • Promoter CMV
  • Tag / Fusion Protein
    • FLAG (N terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site NdeI (not destroyed)
  • 3′ cloning site HindIII (not destroyed)
  • 5′ sequencing primer CMV-Fwd
  • 3′ sequencing primer BGH-Rev
  • (Common Sequencing Primers)

Resource Information

  • Terms and Licenses
  • Industry Terms
    • Not Available to Industry
  • Articles Citing this Plasmid

Depositor Comments

A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    CMV500 A-CREB was a gift from Charles Vinson (Addgene plasmid # 33371 ; http://n2t.net/addgene:33371 ; RRID:Addgene_33371)
  • For your References section:

    A dominant-negative inhibitor of CREB reveals that it is a general mediator of stimulus-dependent transcription of c-fos. Ahn S, Olive M, Aggarwal S, Krylov D, Ginty DD, Vinson C. Mol Cell Biol. 1998 Feb . 18(2):967-77. PubMed 9447994