Skip to main content

Anti-KCNJ6 [BCN132.2.1C10]
(Antibody #210049)

No images are available for this antibody.

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 210049-rAb 100 µg of purified recombinant antibody $262 *

* Log in to view industry pricing.

Features

Production & Usage

  • Purification
    Purified from cell culture supernatant using affinity chromatography followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice

Terms and Licenses

Target Antigen

Protein G protein-activated inward rectifier potassium channel 2
Antigen Description Recombinant fragment of human GIRK2 protein (aa 308–423)
Antigen Amino Acid Sequence
EGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV
Species H. sapiens (human)
Gene KCNJ6
Alternative Names
  • BIR1
  • Inward rectifier K(+) channel Kir3.2
  • KATP-2
  • Potassium channel
  • inwardly rectifying subfamily J member 6
External References

Addgene Comments

How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-KCNJ6 [BCN132.2.1C10] - from CDI Laboratories Inc (CDI), Melina Fan (Addgene antibody # 210049 ; http://n2t.net/addgene:210049)
  • For your References section: