Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected] Learn more

pcDNA3-neo-Strep_Flag_Cterm
(Plasmid #102645)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 102645 Standard format: Plasmid sent in bacteria as agar stab 1 $65

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pcDNA3_neo
  • Backbone manufacturer
    Invitrogen
  • Vector type
    Mammalian Expression
  • Selectable markers
    Neomycin (select with G418)
  • Tag / Fusion Protein
    • SBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPGGMDYKDDD (C terminal on backbone)

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    None
  • Tag / Fusion Protein
    • SBP-Flag, MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPGGMDYKDDD (C terminal on backbone)

Resource Information

  • Terms and Licenses

Depositor Comments

No insert, but contains a single C-terminus Strepavidin binding peptide and Flag epitopes

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pcDNA3-neo-Strep_Flag_Cterm was a gift from Michael E. Wright (Addgene plasmid # 102645)
  • For your References section:

    Androgen receptor and chemokine receptors 4 and 7 form a signaling axis to regulate CXCL12-dependent cellular motility. Hsiao JJ, Ng BH, Smits MM, Wang J, Jasavala RJ, Martinez HD, Lee J, Alston JJ, Misonou H, Trimmer JS, Wright ME. BMC Cancer. 2015 Mar 31;15:204. doi: 10.1186/s12885-015-1201-5. 10.1186/s12885-015-1201-5 [pii] PubMed 25884570