pET21d-colEdes11/Imdes11
(Plasmid
#107119)
-
Purposeplasmid for expression of computationally designed colicin endonuclease and immunity pair, des11
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 107119 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepET21d
- Backbone size w/o insert (bp) 5440
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)T7 Express lysY/Iq (NEB)
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert namecolEdes11/Imdes11
-
SpeciesSynthetic
- Promoter T7
-
Tag
/ Fusion Protein
- His-tag (C terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site NcoI (not destroyed)
- 3′ cloning site XhoI (not destroyed)
- 5′ sequencing primer TAATACGACTCACTATAGGG
- 3′ sequencing primer GCTAGTTATTGCTCAGCGG (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes11: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFKKKFWEEVSKDPDLSKQFKGSNQESIKKGLAPFARQNDQVGGRRVFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes11: MELKHSISDYTEAEFLEFVKKICNLSAGNASVDEMEKAVDEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pET21d-colEdes11/Imdes11 was a gift from Sarel Fleishman (Addgene plasmid # 107119 ; http://n2t.net/addgene:107119 ; RRID:Addgene_107119) -
For your References section:
Ultrahigh specificity in a network of computationally designed protein-interaction pairs. Netzer R, Listov D, Lipsh R, Dym O, Albeck S, Knop O, Kleanthous C, Fleishman SJ. Nat Commun. 2018 Dec 11;9(1):5286. doi: 10.1038/s41467-018-07722-9. 10.1038/s41467-018-07722-9 PubMed 30538236