Skip to main content

RUL1 K1_pECIA14
(Plasmid #114800)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 114800 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pECIA14
  • Backbone manufacturer
    Chris Garcia (Addgene plasmid # 47051)
  • Vector type
    Insect Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    AT5G05160
  • Species
    A. thaliana (mustard weed)
  • Promoter Metallothionein (Copper-Inducible)

Cloning Information

  • Cloning method Ligation Independent Cloning

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Trademarks:

  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: SDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSISKQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSPEYSFIGNSLLCGPPLNACSGGAISPSSNLPRPLTENLHPVRR

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    RUL1 K1_pECIA14 was a gift from Youssef Belkhadir (Addgene plasmid # 114800 ; http://n2t.net/addgene:114800 ; RRID:Addgene_114800)
  • For your References section:

    An extracellular network of Arabidopsis leucine-rich repeat receptor kinases. Smakowska-Luzan E, Mott GA, Parys K, Stegmann M, Howton TC, Layeghifard M, Neuhold J, Lehner A, Kong J, Grunwald K, Weinberger N, Satbhai SB, Mayer D, Busch W, Madalinski M, Stolt-Bergner P, Provart NJ, Mukhtar MS, Zipfel C, Desveaux D, Guttman DS, Belkhadir Y. Nature. 2018 Jan 18;553(7688):342-346. doi: 10.1038/nature25184. Epub 2018 Jan 10. 10.1038/nature25184 PubMed 29320478