PXC2 X021_pECIA14
(Plasmid
#114849)
-
PurposePrey vector PXC2 X021_pECIA14 should be used with bait vector PXC2 X021_pECIA2.
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 114849 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepECIA14
-
Backbone manufacturerChris Garcia (Addgene plasmid # 47051)
-
Vector typeInsect Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameAT5G01890
-
SpeciesA. thaliana (mustard weed)
-
Entrez GeneAT5G01890 (a.k.a. AT5G01890, PXC2, PXY/TDR-correlated 2, T20L15.160, T20L15_160)
- Promoter Metallothionein (Copper-Inducible)
Cloning Information
- Cloning method Ligation Independent Cloning
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags.
Insert Protein Sequence: TFNDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHIGRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEIPDWIGDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDVSKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMPIVGFLQGLRVLDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELPAGGFFNTIPLSAVTGNPSLCGSVVNRSCLSVHPKPIVLNPNSSNPTNGPALTGQIRKS
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
PXC2 X021_pECIA14 was a gift from Youssef Belkhadir (Addgene plasmid # 114849 ; http://n2t.net/addgene:114849 ; RRID:Addgene_114849) -
For your References section:
An extracellular network of Arabidopsis leucine-rich repeat receptor kinases. Smakowska-Luzan E, Mott GA, Parys K, Stegmann M, Howton TC, Layeghifard M, Neuhold J, Lehner A, Kong J, Grunwald K, Weinberger N, Satbhai SB, Mayer D, Busch W, Madalinski M, Stolt-Bergner P, Provart NJ, Mukhtar MS, Zipfel C, Desveaux D, Guttman DS, Belkhadir Y. Nature. 2018 Jan 18;553(7688):342-346. doi: 10.1038/nature25184. Epub 2018 Jan 10. 10.1038/nature25184 PubMed 29320478