pc3XB-ZF112
(Plasmid
#13162)
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 13162 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $75 |
This material is available to academics and nonprofits only.
Backbone
-
Vector backbonepc3XB
-
Backbone manufacturerModified Invitrogen pcDNA3
- Backbone size w/o insert (bp) 5400
-
Vector typeMammalian Expression
-
Selectable markersNeomycin (select with G418)
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin
-
Growth Temperature37°C
-
Growth Strain(s)XL1 Blue
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameZF112
-
Insert Size (bp)90
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site XbaI (not destroyed)
- 3′ cloning site BamHI (not destroyed)
- 5′ sequencing primer T7 (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPYRCKYCDRSFSISSNLQRHVRNIH. Target DNA sequence: GAT. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 13. ToolGen ZF Name: ISNR.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pc3XB-ZF112 was a gift from Keith Joung (Addgene plasmid # 13162 ; http://n2t.net/addgene:13162 ; RRID:Addgene_13162)