ppil2.280.457.Y389H
(Plasmid
#137658)
-
PurposeExpresses N-terminal (His)6-Thrombin cleavage site fusion of human gene or portion of gene with point mutation in bacterial strains. pET based vector.
-
Depositing Labs
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 137658 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 |
Backbone
-
Vector backbonepET28a-LIC
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert nameppil2
-
SpeciesH. sapiens (human)
-
Mutation280-457-Y389H
-
Entrez GenePPIL2 (a.k.a. CYC4, CYP60, Cyp-60, UBOX7, hCyP-60)
-
Tag
/ Fusion Protein
- (His)6-thrombin (N terminal on backbone)
Cloning Information
- Cloning method Ligation Independent Cloning
- 5′ sequencing primer T7F and LIC primer: tttcgctcctgtgcccacctggacaagaagc
- 3′ sequencing primer T7R and LIC primer: gcttcttgtccaggtgggcacaggagcgaaa (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
MGSSHHHHHHSSGLVPRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAHLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
ppil2.280.457.Y389H was a gift from Tara Davis & Melissa Jurica (Addgene plasmid # 137658 ; http://n2t.net/addgene:137658 ; RRID:Addgene_137658) -
For your References section:
Structural and biochemical characterization of the human cyclophilin family of peptidyl-prolyl isomerases. Davis TL, Walker JR, Campagna-Slater V, Finerty PJ, Paramanathan R, Bernstein G, MacKenzie F, Tempel W, Ouyang H, Lee WH, Eisenmesser EZ, Dhe-Paganon S. PLoS Biol. 2010 Jul 27;8(7):e1000439. doi: 10.1371/journal.pbio.1000439. 10.1371/journal.pbio.1000439 PubMed 20676357