pETM33_Nsp3c_SUD-N
(Plasmid
#156469)
-
PurposeBacterial expression of Sars-CoV2 Nsp3c_SUD-N protein with His-tag and GST-tag
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 156469 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepETM33
- Backbone size w/o insert (bp) 6017
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Growth instructionsGrowth in BL21 DE3 gold 37˚C after induction with 1mM 16hours 18˚C
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameNsp3c_SUD-N
-
SpeciesSynthetic; Severe acute respiratory syndrome coronavirus 2
-
MutationGene insert is codon optimized for Ecoli.
-
Entrez GeneORF1ab (a.k.a. GU280_gp01)
- Promoter T7/LacO
-
Tag
/ Fusion Protein
- His-GST (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Nco1 (destroyed during cloning)
- 3′ cloning site EcoR1 (destroyed during cloning)
- 5′ sequencing primer CGGATCTGGAAGTTCTGTTCC
- 3′ sequencing primer GAGTGCGGCCGCAAGCTTG (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
insert amino acid sequence: MDMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPS
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pETM33_Nsp3c_SUD-N was a gift from Ylva Ivarsson (Addgene plasmid # 156469 ; http://n2t.net/addgene:156469 ; RRID:Addgene_156469) -
For your References section:
Identification of motif-based interactions between SARS-CoV-2 protein domains and human peptide ligands pinpoint antiviral targets. Mihalic F, Benz C, Kassa E, Lindqvist R, Simonetti L, Inturi R, Aronsson H, Andersson E, Chi CN, Davey NE, Overby AK, Jemth P, Ivarsson Y. Nat Commun. 2023 Sep 13;14(1):5636. doi: 10.1038/s41467-023-41312-8. 10.1038/s41467-023-41312-8 PubMed 37704626