Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

pETM33_Nsp3e_NAB
(Plasmid #156473)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 156473 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    pETM33
  • Backbone size w/o insert (bp) 6017
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Growth instructions
    Growth in BL21 DE3 gold 37˚C after induction with 1mM 16hours 18˚C
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    Nsp3e_NAB
  • Species
    Synthetic; Severe acute respiratory syndrome coronavirus 2
  • Mutation
    Gene insert is codon optimized for Ecoli.
  • Entrez Gene
    ORF1ab (a.k.a. GU280_gp01)
  • Promoter T7/LacO
  • Tag / Fusion Protein
    • His-GST (N terminal on backbone)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site Nco1 (destroyed during cloning)
  • 3′ cloning site EcoR1 (destroyed during cloning)
  • 5′ sequencing primer CGGATCTGGAAGTTCTGTTCC
  • 3′ sequencing primer GAGTGCGGCCGCAAGCTTG
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

insert amino acid sequence: GKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETx

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pETM33_Nsp3e_NAB was a gift from Ylva Ivarsson (Addgene plasmid # 156473 ; http://n2t.net/addgene:156473 ; RRID:Addgene_156473)
  • For your References section:

    Identification of motif-based interactions between SARS-CoV-2 protein domains and human peptide ligands pinpoint antiviral targets. Mihalic F, Benz C, Kassa E, Lindqvist R, Simonetti L, Inturi R, Aronsson H, Andersson E, Chi CN, Davey NE, Overby AK, Jemth P, Ivarsson Y. Nat Commun. 2023 Sep 13;14(1):5636. doi: 10.1038/s41467-023-41312-8. 10.1038/s41467-023-41312-8 PubMed 37704626