pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt
(Plasmid
#162821)
-
PurposeSTELLA plasmid for amber suppression of N-terminally labelled CoV2_ORF3b_alt
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 162821 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepAS
-
Vector typeMammalian Expression ; PiggyBac
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)NEB Stable
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameUb-(N-TAG)CoV2_ORF3b_alt
-
SpeciesSARS-CoV-2
-
MutationCoV2_ORF3b_alt(Met1,Amber)
- Promoter EF1alpha
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Unknown (unknown if destroyed)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pAS1_4x7SKPylT_EF1_Ub-*CoV2_ORF3b_alt was a gift from Simon Elsaesser (Addgene plasmid # 162821 ; http://n2t.net/addgene:162821 ; RRID:Addgene_162821) -
For your References section:
Universal Single-Residue Terminal Labels for Fluorescent Live Cell Imaging of Microproteins. Lafranchi L, Schlesinger D, Kimler KJ, Elsasser SJ. J Am Chem Soc. 2020 Nov 25;142(47):20080-20087. doi: 10.1021/jacs.0c09574. Epub 2020 Nov 11. 10.1021/jacs.0c09574 PubMed 33175524