Skip to main content
Addgene

1D3 LC
(Plasmid #170669)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 170669 Standard format: Plasmid sent in bacteria as agar stab 1 $89 *

* Log in to view industry pricing.

Backbone

  • Vector backbone
    pcDNA3.1
  • Vector type
    Mammalian Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
  • Species
    M. musculus (mouse)

Cloning Information

Terms and Licenses

Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    1D3 LC was a gift from Ronald Jemmerson & Rafel Radi (Addgene plasmid # 170669 ; http://n2t.net/addgene:170669 ; RRID:Addgene_170669)
  • For your References section:

    De novo sequencing and construction of a unique antibody for the recognition of alternative conformations of cytochrome c in cells. Tomasina F, Martinez J, Zeida A, Chiribao ML, Demicheli V, Correa A, Quijano C, Castro L, Carnahan RH, Vinson P, Goff M, Cooper T, McDonald WH, Castellana N, Hannibal L, Morse PT, Wan J, Huttemann M, Jemmerson R, Piacenza L, Radi R. Proc Natl Acad Sci U S A. 2022 Nov 22;119(47):e2213432119. doi: 10.1073/pnas.2213432119. Epub 2022 Nov 15. 10.1073/pnas.2213432119 PubMed 36378644