1D3 LC
(Plasmid
#170669)
-
PurposeMammalian Expression Plasmid of Anti-cytochrome c, 1D3 LC (Human)
-
Depositing Labs
-
Sequence Information
-
Sequences (1) — Accept Affinity Reagent Sequence Policy
-
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 170669 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $85 * | |
* Login to view industry pricing.
Backbone
-
Vector backbonepcDNA3.1
-
Vector typeMammalian Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameLC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
-
SpeciesM. musculus (mouse)
Cloning Information
- Cloning method Unknown
- 5′ sequencing primer Unknown (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*
How to cite this plasmid
( Back to top)
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
1D3 LC was a gift from Ronald Jemmerson & Rafel Radi (Addgene plasmid # 170669 ; http://n2t.net/addgene:170669 ; RRID:Addgene_170669) -
For your References section:
De novo sequencing and construction of a unique antibody for the recognition of alternative conformations of cytochrome c in cells. Tomasina F, Martinez J, Zeida A, Chiribao ML, Demicheli V, Correa A, Quijano C, Castro L, Carnahan RH, Vinson P, Goff M, Cooper T, McDonald WH, Castellana N, Hannibal L, Morse PT, Wan J, Huttemann M, Jemmerson R, Piacenza L, Radi R. Proc Natl Acad Sci U S A. 2022 Nov 22;119(47):e2213432119. doi: 10.1073/pnas.2213432119. Epub 2022 Nov 15. 10.1073/pnas.2213432119 PubMed 36378644
