Syk tSH2 R44A in pET-30a(+)
(Plasmid
#172856)
-
Purposeexpress murine Syk tandem SH2 domains (Ser 8 to Gln 264), with R44A mutation and a TEV-cleavable His-tag. For use in E.coli strain Rosetta 2 (DE3).
-
Depositing Lab
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 172856 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 |
Backbone
-
Vector backbonepET-30a(+)
-
Backbone manufacturerNovagen
- Backbone size w/o insert (bp) 5422
- Total vector size (bp) 6081
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Growth instructionsProvided by Addgene in DH5alpha. Use Rosetta 2 (DE3) for expression studies.
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert namemurine Syk tandem SH2 domains (Ser 8 to Gln 264), with R44A mutation and a TEV-cleavable His-tag
-
Alt nameSpleen tyrosine kinase
-
SpeciesM. musculus (mouse)
-
Insert Size (bp)852
-
MutationR44A
-
GenBank IDNP_035648
-
Entrez GeneSyk (a.k.a. Sykb)
- Promoter T7
-
Tag
/ Fusion Protein
- TEV-cleavable His-tag (N terminal on insert)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site NdeI (unknown if destroyed)
- 3′ cloning site XhoI (unknown if destroyed)
- 5′ sequencing primer T7 promoter
- 3′ sequencing primer T7 terminator (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
encoding the following protein sequence: MGSSHHHHHHDYDIPTTENLYFQSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSANYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ–
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
Syk tSH2 R44A in pET-30a(+) was a gift from Carol Post (Addgene plasmid # 172856)