Skip to main content

Anti-Pan-Shank [N23B/49R]
(Antibody #180095)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 180095-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 180095-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Pan-Shank [N23B/49R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9-1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750756

Terms and Licenses

Target Antigen (3)

Protein SH3 and multiple ankyrin repeat domains protein 1
Antigen Description Amino acids 84-309 (SH3/PDZ domains) of rat Shank2
Antigen Amino Acid Sequence
QTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELLLYNRAQLGI
Species R. norvegicus (rat)
Additional Species Reactivity H. sapiens (human),  M. musculus (mouse)
Gene Shank1
Alternative Names
  • GKAP/SAPAP-interacting protein
  • SPANK-1
  • Somatostatin receptor-interacting protein
  • SSTR-interacting protein
  • SSTRIP
  • Synamon
External References
Protein SH3 and multiple ankyrin repeat domains protein 2
Antigen Description Amino acids 84-309 (SH3/PDZ domains) of rat Shank2
Species R. norvegicus (rat)
Gene Shank2
Alternative Names
  • Cortactin-binding protein 1
  • CortBP1
  • GKAP/SAPAP-interacting protein
  • Proline-rich synapse-associated protein 1
  • ProSAP1
  • SPANK-3
External References
Protein SH3 and multiple ankyrin repeat domains protein 3
Antigen Description Amino acids 84-309 (SH3/PDZ domains) of rat Shank2
Species R. norvegicus (rat)
Gene Shank3
Alternative Names
  • Proline-rich synapse-associated protein 2
  • ProSAP2
  • SPANK-2
External References

Applications (1)

Western Blot

1 image
Western Blot image by UC Davis/NIH NeuroMab Facility
Submitted By: UC Davis/NIH NeuroMab Facility
Antibody Type
Hybridoma
Target Species
R. norvegicus (rat)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Pan-Shank [N23B/49R] - from James Trimmer (Addgene antibody # 180095 ; http://n2t.net/addgene:180095 ; RRID:AB_2750756)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. eLife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360