Skip to main content

Anti-TRIP8b (constant) [N212/17R]
(Antibody #180109)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 180109-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 180109-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2750748

Terms and Licenses

Target Antigen

Protein PEX5-related protein
Antigen Description Amino acids 1–192 (exon 1a, exon 4 and constant region) of rat TRIP8b
Antigen Amino Acid Sequence
MYQGHMQGKGSRAADKAVAMVMKEIPREESAEEKPLLTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIAKPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSESSSKSSSLKKKADGSDLISADAEQRAQALRGPETSSLDLDIQTQLEKWDDVKFHGDRTSKGHLMAERKSCSSRAGSKELLWSSEHRS
Species R. norvegicus (rat)
Additional Species Reactivity H. sapiens (human),  M. musculus (mouse)
Gene Pex5l
Alternative Names
  • PEX5-like protein
  • Peroxin-5-related protein
  • TPR-containing Rab8b-interacting protein
  • Tetratricopeptide repeat-containing Rab8b-interacting protein
  • Pex5Rp
  • TRIP8b
External References

Applications (1)

Clear filters

Immunohistochemistry

1 image
Immunohistochemistry image by Zhuhao Wu, Weill Cornell Medicine
Submitted By: Zhuhao Wu, Weill Cornell Medicine
Addgene Partner
Antibody Type
Recombinant
Target Species
M. musculus (mouse)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-TRIP8b (constant) [N212/17R] - from James Trimmer (Addgene antibody # 180109 ; http://n2t.net/addgene:180109 ; RRID:AB_2750748)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. eLife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360