Skip to main content

Anti-Cav1.2/1.3 Ca2+ channel [L57/46R]
(Antibody #182223)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 182223-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 182223-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

  • Production Plasmid
    Anti-Cav1.2/1.3 Ca2+ channel [L57/46R]
  • Purification
    Purified from cell culture supernatant using Protein A or Protein G affinity columns followed by a buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2909551

Terms and Licenses

Target Antigen

Protein Voltage-dependent L-type calcium channel subunit alpha-1C
Antigen Description Amino acids 1507–1733 (intracellular carboxyl terminus) of rabbit Cav1.2
Antigen Amino Acid Sequence
DNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLF
Species O. cuniculus (rabbit)
Additional Species Reactivity M. musculus (mouse),  R. norvegicus (rat)
Gene CACNA1C
Alternative Names
  • Calcium channel
  • L type
  • alpha-1 polypeptide
  • isoform 1
  • cardiac muscle
  • Smooth muscle calcium channel blocker receptor
  • CACB-receptor
  • Voltage-gated calcium channel subunit alpha Cav1.2
External References

Applications (1)

Clear filters

Immunocytochemistry

1 image
Immunocytochemistry image by James Trimmer, UC Davis
Submitted By: James Trimmer, UC Davis
Addgene Partner
Antibody Type
Recombinant
Target Species
Other
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Cav1.2/1.3 Ca2+ channel [L57/46R] - from James Trimmer (Addgene antibody # 182223 ; http://n2t.net/addgene:182223 ; RRID:AB_2909551)
  • For your References section:

    High-volume hybridoma sequencing on the NeuroMabSeq platform enables efficient generation of recombinant monoclonal antibodies and scFvs for neuroscience research. Mitchell KG, Gong B, Hunter SS, Burkart-Waco D, Gavira-O'Neill CE, Templeton KM, Goethel ME, Bzymek M, MacNiven LM, Murray KD, Settles ML, Froenicke L, Trimmer JS. Sci Rep. 2023 Sep 27;13(1):16200. doi: 10.1038/s41598-023-43233-4. 10.1038/s41598-023-43233-4 PubMed 37758930