Skip to main content

Anti-Pan-Gamma-Protocadherin-(constant) [N159/5R]
(Antibody #184189)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 184189-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 184189-rAb.T 20 µg of purified recombinant antibody $85 *

* Log in to view industry pricing.

Features

Production & Usage

Delivery

  • Concentration
    0.9-1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2909560

Terms and Licenses

Target Antigen

Protein Protocadherin gamma A1
Antigen Description Amino acids 808-931 (C-terminal cytoplasmic constant domain) of mouse Gamma-protocadherin-A1
Antigen Amino Acid Sequence
QAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Species M. musculus (mouse)
Gene Pcdhga1
External References

Applications (1)

Clear filters

Western Blot

1 image
Western Blot image by Joshua Weiner, University of Iowa
Submitted By: Joshua Weiner, University of Iowa
Antibody Type
Hybridoma
Target Species
M. musculus (mouse)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-Pan-Gamma-Protocadherin-(constant) [N159/5R] - from James Trimmer (Addgene antibody # 184189 ; http://n2t.net/addgene:184189 ; RRID:AB_2909560)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. eLife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360