Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

Anti-PSD-95 [K28/43] - Chimeric
(Antibody #196561)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 196561-rAb 100 µg of purified recombinant antibody $250 *
Recombinant Antibody trial size 196561-rAb.T 20 µg of purified recombinant antibody $85 *

* Login to view industry pricing.

Features

Production & Usage

  • Purification
    Purification from cell culture supernatant using affinity chromatography followed by buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_2928071

Terms and Licenses

Target Antigen

Protein Disks large homolog 4
Antigen Description Amino acids 77–299 (PDZ domains 1 and 2) of human PSD-95
Antigen Amino Acid Sequence
FSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAK
Species H. sapiens (human)
Gene DLG4
Alternative Names
  • Postsynaptic density protein 95
  • PSD-95
  • Synapse-associated protein 90
  • SAP-90
  • SAP90
External References

Applications (1)

Western Blot

1 image
Western Blot image by Addgene
Submitted By: Addgene
Antibody Type
Recombinant
Sample Species
R. norvegicus (rat)
Result
Pass

Addgene Comments

This antibody has been engineered from sequences from a mouse monoclonal parent antibody. By necessity, some mouse sequences are retained. When multiplexing with mouse antibodies, we recommend using Fc-directed, pre-adsorbed secondary antibodies.
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-PSD-95 [K28/43] - Chimeric - from Melina Fan, James Trimmer (Addgene antibody # 196561 ; http://n2t.net/addgene:196561 ; RRID:AB_2928071)
  • For your References section:

    A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain. Andrews NP, Boeckman JX, Manning CF, Nguyen JT, Bechtold H, Dumitras C, Gong B, Nguyen K, van der List D, Murray KD, Engebrecht J, Trimmer JS. Elife. 2019 Jan 22;8. pii: 43322. doi: 10.7554/eLife.43322. 10.7554/eLife.43322 PubMed 30667360