pEGFPC2-gephyrin C3
              
              
                (Plasmid
                
                #199610)
              
            
            
            
          - 
            PurposeEncodes N-terminal eGFP-tagged gephyrin including the C3 splice cassette for expression in mammalian cells.
 - 
              Depositing Lab
 - 
          Sequence Information
 
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 199610 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
- 
            Vector backbonepEGFPC2
 - 
              Backbone manufacturerClontech
 - Backbone size w/o insert (bp) 4700
 - 
              Vector typeMammalian Expression
 - 
                Selectable markersNeomycin (select with G418)
 
Growth in Bacteria
- 
            Bacterial Resistance(s)Kanamycin, 50 μg/mL
 - 
            Growth Temperature37°C
 - 
            Growth Strain(s)NEB Stable
 - 
            Copy numberHigh Copy
 
Gene/Insert
- 
                Gene/Insert nameGephyrin
 - 
                    SpeciesR. norvegicus (rat)
 - 
                  MutationC3 cassette insertion
 - 
                        Entrez GeneGphn (a.k.a. Geph)
 - Promoter CMV
 - 
    
        Tag
        / Fusion Protein
    
- EGFP (N terminal on backbone)
 
 
Cloning Information
- Cloning method Restriction Enzyme
 - 5′ cloning site XhoI (unknown if destroyed)
 - 3′ cloning site KpnI (unknown if destroyed)
 - 5′ sequencing primer CGCAAATGGGCGGTAGGCGTG (Common Sequencing Primers)
 
Terms and Licenses
- 
        Academic/Nonprofit Terms
 - 
      Industry Terms
- Not Available to Industry
 
 
Trademarks:
- Zeocin® is an InvivoGen trademark.
 
Depositor Comments
Gephyrin C3 cassette encodes NHPFYTSPAVFMANHGQPIPGLISYSHHATGSADKR after K243 (Thought to be expressed in astrocytes for MoCo biosynthesis and prevents olgomerization of gephyrin molecules for synapse scaffolding function in neurons)
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
- 
              
For your Materials & Methods section:
pEGFPC2-gephyrin C3 was a gift from Shiva Tyagarajan (Addgene plasmid # 199610 ; http://n2t.net/addgene:199610 ; RRID:Addgene_199610) - 
                
For your References section:
A DARPin-based molecular toolset to probe gephyrin and inhibitory synapse biology. Campbell BFN, Dittmann A, Dreier B, Pluckthun A, Tyagarajan SK. Elife. 2022 Oct 31;11:e80895. doi: 10.7554/eLife.80895. 10.7554/eLife.80895 PubMed 36314779