Skip to main content

pGCNK58
(Plasmid #202461)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 202461 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    pet3b
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Unknown

Gene/Insert

  • Gene/Insert name
    Residues 226-281 of Sacchromyces cerevisiae GCN4 plus an N-terminal Met-Lys extension
  • Alt name
    MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
  • Species
    S. cerevisiae (budding yeast)
  • Insert Size (bp)
    177
  • Entrez Gene
    GCN4 (a.k.a. YEL009C, AAS101, AAS3, ARG9)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

Dynamics of GCN4 facilitate DNA interaction: a model-free analysis of an intrinsically disordered region. Gill ML, Byrd RA, Palmer AG III. Phys Chem Chem Phys. 2016 Feb 17;18(8):5839-49. doi: 10.1039/c5cp06197k.

The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted a-helices: crystal structure of the protein-DNA complex. Ellenberger, T. E., Brandl, C. J., Struhl, K. & Harrison, S. C. (1992). Cell, 71, 1223-1237. PMID 1473154.

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pGCNK58 was a gift from Stephen Harrison & Arthur Palmer (Addgene plasmid # 202461 ; http://n2t.net/addgene:202461 ; RRID:Addgene_202461)
  • For your References section:

    Folding transition in the DNA-binding domain of GCN4 on specific binding to DNA. Weiss MA, Ellenberger T, Wobbe CR, Lee JP, Harrison SC, Struhl K. Nature. 1990 Oct 11;347(6293):575-8. doi: 10.1038/347575a0. 10.1038/347575a0 PubMed 2145515