pGCNK58
(Plasmid #202461)

• Purpose: Plasmid for the expression of the basic region and leucine zipper domain of the Saccharomyces cerevisiae transcription factor GCN4 in bacterial cells
• Depositing Labs: Stephen Harrison, Arthur Palmer
• Publication: Weiss et al Nature. 1990 Oct 11;347(6293):575-8. doi: 10.1038/347575a0.

Backbone

• Vector backbone: pet3b
• Vector type: Bacterial Expression

Growth in Bacteria

• Bacterial Resistance(s): Ampicillin, 100 μg/mL
• Growth Temperature: 37°C
• Growth Strain(s): DH5alpha
• Copy number: Unknown

Gene/Insert

• Gene/Insert name: Residues 226-281 of Sacchromyces cerevisiae GCN4 plus an N-terminal Met-Lys extension
• Alt name: MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
• Species: S. cerevisiae (budding yeast)
• Insert Size (bp): 177
• Entrez Gene: GCN4 (a.k.a. YEL009C, AAS101, AAS3, ARG9)

Terms and Licenses

• Academic/Nonprofit Terms:
  • UBMTA
• Industry Terms:
  • Not Available to Industry

Depositor Comments

Dynamics of GCN4 facilitate DNA interaction: a model-free analysis of an intrinsically disordered region. Gill ML, Byrd RA, Palmer AG III. Phys Chem Chem Phys. 2016 Feb 17;18(8):5839-49. doi: 10.1039/c5cp06197k.

The GCN4 basic region leucine zipper binds DNA as a dimer of uninterrupted a-helices: crystal structure of the protein-DNA complex. Ellenberger, T. E., Brandl, C. J., Struhl, K. & Harrison, S. C. (1992). Cell, 71, 1223-1237. PMID 1473154.