-
PurposeDimerization dependent fluorescent protein GA anchored to cytosolic face of the mitochondrial membrane with C-terminal targeting sequence of human MAVS
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 209865 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonemEmerald-C1
-
Vector typeMammalian Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameddGFP A
-
SpeciesSynthetic
- Promoter CMV
-
Tag
/ Fusion Protein
- Targeting domain of MAVS RPSPGALWLQVAVTGVLVVTLLVVLYRRRLH (C terminal on insert)
Cloning Information
- Cloning method Gibson Cloning
Resource Information
-
Supplemental Documents
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
mEmerald was replaced with ddGFP A
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
Mito-GA was a gift from Sarah Cohen (Addgene plasmid # 209865 ; http://n2t.net/addgene:209865 ; RRID:Addgene_209865) -
For your References section:
Contact-FP: A Dimerization-Dependent Fluorescent Protein Toolkit for Visualizing Membrane Contact Site Dynamics. Miner GE, Smith SY, Showalter WK, So CM, Ragusa JV, Powers AE, Zanellati MC, Hsu CH, Marchan MF, Cohen S. Contact (Thousand Oaks). 2024 Feb 4;7:25152564241228911. doi: 10.1177/25152564241228911. eCollection 2024 Jan-Dec. 10.1177/25152564241228911 PubMed 38327561