Skip to main content
This website uses cookies to ensure you get the best experience. By continuing to use this site, you agree to the use of cookies.

Please note: Your browser does not support the features used on Addgene's website. You may not be able to create an account or request plasmids through this website until you upgrade your browser. Learn more

Please note: Your browser does not fully support some of the features used on Addgene's website. If you run into any problems registering, depositing, or ordering please contact us at [email protected]. Learn more

Addgene

Mito-GA
(Plasmid #209865)

Ordering

Item Catalog # Description Quantity Price (USD)
Plasmid 209865 Standard format: Plasmid sent in bacteria as agar stab 1 $85

This material is available to academics and nonprofits only.

Backbone

  • Vector backbone
    mEmerald-C1
  • Vector type
    Mammalian Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Kanamycin, 50 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    ddGFP A
  • Species
    Synthetic
  • Promoter CMV
  • Tag / Fusion Protein
    • Targeting domain of MAVS RPSPGALWLQVAVTGVLVVTLLVVLYRRRLH (C terminal on insert)

Cloning Information

  • Cloning method Gibson Cloning

Resource Information

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

mEmerald was replaced with ddGFP A

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Mito-GA was a gift from Sarah Cohen (Addgene plasmid # 209865 ; http://n2t.net/addgene:209865 ; RRID:Addgene_209865)
  • For your References section:

    Contact-FP: A Dimerization-Dependent Fluorescent Protein Toolkit for Visualizing Membrane Contact Site Dynamics. Miner GE, Smith SY, Showalter WK, So CM, Ragusa JV, Powers AE, Zanellati MC, Hsu CH, Marchan MF, Cohen S. Contact (Thousand Oaks). 2024 Feb 4;7:25152564241228911. doi: 10.1177/25152564241228911. eCollection 2024 Jan-Dec. 10.1177/25152564241228911 PubMed 38327561