pNLF1-N_DDB2:1-427
(Plasmid
#211068)
-
PurposeMammalian expression of full-length human DDB2. N-terminal NanoLuc luciferase tag.
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 211068 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepNLF1-N
-
Backbone manufacturerPromega
-
Vector typeMammalian Expression
-
Selectable markersHygromycin
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameDDB2:M1-K427
-
SpeciesH. sapiens (human)
-
Insert Size (bp)1281
-
Mutationwild type
-
Entrez GeneDDB2 (a.k.a. DDBB, UV-DDB2, XPE)
- Promoter CMV
-
Tag
/ Fusion Protein
- NanoLuc luciferase (N terminal on insert)
Cloning Information
- Cloning method Ligation Independent Cloning
- 5′ sequencing primer gtaaccatcaacggagtgac
- 3′ sequencing primer tatcatgtctgctcgaagc
- (Common Sequencing Primers)
Resource Information
-
A portion of this plasmid was derived from a plasmid made byMammalian Gene Collection (BC000093)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
5' Cloning Site: EcoR1 (not destroyed), 3' Cloning Site: Xba1 (not destroyed). N terminal tag: mvftledfvgdwrqtagynldqvleqggvsslfqnlgvsvtpiqrivlsgenglkidihviipyeglsgdqmgqiekifkvvypvddhhfkvilhygtlvidgvtpnmidyfgrpyegiavfdgkkitvtgtlwngnkiiderlinpdgsllfrvtingvtgwrlcerilagssgaiasef.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pNLF1-N_DDB2:1-427 was a gift from Cheryl Arrowsmith (Addgene plasmid # 211068 ; http://n2t.net/addgene:211068 ; RRID:Addgene_211068) -
For your References section:
A Target Class Ligandability Evaluation of WD40 Repeat-Containing Proteins. Ackloo S, Li F, Szewczyk M, Seitova A, Loppnau P, Zeng H, Xu J, Ahmad S, Arnautova YA, Baghaie AJ, Beldar S, Bolotokova A, Centrella PA, Chau I, Clark MA, Cuozzo JW, Dehghani-Tafti S, Disch JS, Dong A, Dumas A, Feng JA, Ghiabi P, Gibson E, Gilmer J, Goldman B, Green SR, Guie MA, Guilinger JP, Harms N, Herasymenko O, Houliston S, Hutchinson A, Kearnes S, Keefe AD, Kimani SW, Kramer T, Kutera M, Kwak HA, Lento C, Li Y, Liu J, Loup J, Machado RAC, Mulhern CJ, Perveen S, Righetto GL, Riley P, Shrestha S, Sigel EA, Silva M, Sintchak MD, Slakman BL, Taylor RD, Thompson J, Torng W, Underkoffler C, von Rechenberg M, Walsh RT, Watson I, Wilson DJ, Wolf E, Yadav M, Yazdi AK, Zhang J, Zhang Y, Santhakumar V, Edwards AM, Barsyte-Lovejoy D, Schapira M, Brown PJ, Halabelian L, Arrowsmith CH. J Med Chem. 2025 Jan 23;68(2):1092-1112. doi: 10.1021/acs.jmedchem.4c02010. Epub 2024 Nov 4. 10.1021/acs.jmedchem.4c02010 PubMed 39495097