Skip to main content

Anti-SARS-CoV-2 Nucleocapsid Protein [mBG86]
(Antibody #211757)

Ordering

Item Catalog # Description Quantity Price (USD)
Recombinant Antibody 211757-rAb 100 µg of purified recombinant antibody $250 *

* Log in to view industry pricing.

Features

Production & Usage

  • Antigen Plasmid
    pLVX-EF1alpha-SARS-CoV-2-N-2xStrep-IRES-Puro
  • Purification
    Purification from cell culture supernatant using affinity chromatography followed by buffer exchange with centrifugal columns.
  • Storage Buffer
    PBS + 1 mM sodium azide

Delivery

  • Concentration
    0.9–1.1 mg/mL
  • Storage
    Upon receipt, prepare single use aliquots and store at -20 °C until use. Avoid multiple freeze thaw cycles.
  • Shipment
    Blue ice or room temp

Resource Information

  • Persistent Resource Identifier
    RRID:AB_3083606

Terms and Licenses

Target Antigen

Protein Nucleoprotein
Antigen Description Amino acids 133–419 of the SARS-CoV-2 (isolate USA-WA1/2020) N protein with a N-terminal T7 leader sequence to improve translation efficiency
Antigen Amino Acid Sequence
VATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
Epitope Amino acids 133-179
Epitope Amino Acid Sequence
VATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGG
Species Other
Gene N
Alternative Names
  • Nucleocapsid protein
  • NC
  • Protein N
External References

Applications (1)

Western Blot

1 image
Western Blot image by Amrita Rhoads, Katherine Nardone
Submitted By: Addgene
Antibody Type
Recombinant
Target Species
H. sapiens (human)
Result
Pass
How to cite this antibody ( Back to top)

These antibodies were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the antibodies were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    Anti-SARS-CoV-2 Nucleocapsid Protein [mBG86] - from Brian Geiss (Addgene antibody # 211757 ; http://n2t.net/addgene:211757 ; RRID:AB_3083606)
  • For your References section:

    Development of a SARS-CoV-2 nucleocapsid specific monoclonal antibody. Terry JS, Anderson LB, Scherman MS, McAlister CE, Perera R, Schountz T, Geiss BJ. Virology. 2021 Jun;558:28-37. doi: 10.1016/j.virol.2021.01.003. Epub 2021 Feb 1. 10.1016/j.virol.2021.01.003 PubMed 33714753