PCDF Bravo-PotH-OL2del
(Plasmid
#216750)
-
PurposeStudy the interaction of PotH in E. coli, specifically focusing on the role of the outer loop 2 (OL2) by examining the variant lacking OL1 in its interaction with exogenous peptides.
-
Depositing Lab
-
Publication
-
Sequence Information
Ordering
Item | Catalog # | Description | Quantity | Price (USD) | |
---|---|---|---|---|---|
Plasmid | 216750 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 |
Backbone
-
Vector backbonePCDF Bravo
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Streptomycin, 50 μg/mL
-
Growth TemperatureRoom Temperature
-
Growth Strain(s)DH5alpha
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert namepotH
-
SpeciesE. coli (Bacteria)
-
MutationOuter loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted.
-
Entrez GenepotH (a.k.a. b0856, ECK0847)
-
Tag
/ Fusion Protein
- 10x His (C terminal on insert)
Cloning Information
- Cloning method Ligation Independent Cloning
Resource Information
-
A portion of this plasmid was derived from a plasmid made byDNASU Plasmid Repository (ID: EcCD00397460)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
IPTG inducible
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
PCDF Bravo-PotH-OL2del was a gift from Gordon Laurie (Addgene plasmid # 216750 ; http://n2t.net/addgene:216750 ; RRID:Addgene_216750)