Skip to main content
Addgene

PCDF Bravo-PotH-OL2del
(Plasmid #216750)

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 216750 Standard format: Plasmid sent in bacteria as agar stab 1 $89

Backbone

  • Vector backbone
    PCDF Bravo
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Streptomycin, 50 μg/mL
  • Growth Temperature
    Room Temperature
  • Growth Strain(s)
    DH5alpha
  • Copy number
    Low Copy

Gene/Insert

  • Gene/Insert name
    potH
  • Species
    E. coli (Bacteria)
  • Mutation
    Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted.
  • Entrez Gene
    potH (a.k.a. b0856, ECK0847)
  • Tag / Fusion Protein
    • 10x His (C terminal on insert)

Cloning Information

  • Cloning method Ligation Independent Cloning

Resource Information

  • A portion of this plasmid was derived from a plasmid made by
    DNASU Plasmid Repository (ID: EcCD00397460)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry
Trademarks:
  • Zeocin® is an InvivoGen trademark.

Depositor Comments

IPTG inducible

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    PCDF Bravo-PotH-OL2del was a gift from Gordon Laurie (Addgene plasmid # 216750 ; http://n2t.net/addgene:216750 ; RRID:Addgene_216750)