PCDF Bravo-PotH-OL3/2sub
(Plasmid
#216752)
-
PurposeStudy the interaction of PotH in E. coli, specifically focusing on the variant in which outer loop 2 (OL2) is substituted with OL3 in its interaction with exogenous peptides.
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 216752 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonePCDF Bravo
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Streptomycin, 50 μg/mL
-
Growth TemperatureRoom Temperature
-
Growth Strain(s)DH5alpha
-
Copy numberLow Copy
Gene/Insert
-
Gene/Insert namepotH
-
SpeciesE. coli (Bacteria)
-
MutationOuter loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW].
-
Entrez GenepotH (a.k.a. b0856, ECK0847)
-
Tag
/ Fusion Protein
- 10x His (C terminal on insert)
Cloning Information
- Cloning method Ligation Independent Cloning
Resource Information
-
A portion of this plasmid was derived from a plasmid made byDNASU Plasmid Repository (ID: EcCD00397460)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
IPTG inducible
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
PCDF Bravo-PotH-OL3/2sub was a gift from Gordon Laurie (Addgene plasmid # 216752 ; http://n2t.net/addgene:216752 ; RRID:Addgene_216752) -
For your References section:
Lacritin cleavage-potentiated targeting of iron - respiratory reciprocity promotes bacterial death. Sharifian Gh M, Norouzi F, Sorci M, Zaidi TS, Pier GB, Achimovich A, Ongwae GM, Liang B, Ryan M, Lemke M, Belfort G, Gadjeva M, Gahlmann A, Pires MM, Venter H, Harris TE, Laurie GW. J Biol Chem. 2025 May;301(5):108455. doi: 10.1016/j.jbc.2025.108455. Epub 2025 Mar 26. 10.1016/j.jbc.2025.108455 PubMed 40154612