pBXNPFLAGH_BN008H-P
(Plasmid
#218081)
-
PurposeRESOLUTE SLC binder expression plasmid
-
Depositing Labs
-
Sequence Information
-
Sequences (1) — Accept Affinity Reagent Sequence Policy
-
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 218081 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepBXNPFLAGH
-
Vector typeBacterial Expression
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberUnknown
Gene/Insert
-
Gene/Insert nameBN008H-P
-
SpeciesSynthetic
-
Tags
/ Fusion Proteins
- PelB (N terminal on backbone)
- FLAG-His (C terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Unknown (unknown if destroyed)
Resource Information
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
Amino Acid Sequence of Insert: QVQLVESGGGLVQAGGSLRLSCAASGFPVAYKFMYWYRQAPGKEREWVAAIESQGSFTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCHVYVGMEYWGQGTQVTVSS.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pBXNPFLAGH_BN008H-P was a gift from RESOLUTE Consortium & Giulio Superti-Furga (Addgene plasmid # 218081 ; http://n2t.net/addgene:218081 ; RRID:Addgene_218081) -
For your References section:
Protein binder toolbox for studies of solute carrier transporters. Gelová Z, Ingles-Prieto A, Bohstedt T, Frommelt F, Chi G, Chang YN, Garcia J, Wolf G, Azzollini L, Tremolada S, Scacioc A, Hansen JS, Serrano I, Droce A, Cuesta Bernal J, Burgess-Brown NA, Carpenter EP, Durr KL, Kristensen P, Geertsma ER, Stefanic S, Scarabottolo L, Wiedmer T, Puetter V, Sauer DB, Superti-Furga G. J Mol Biol. 2024 Jun 13:168665. doi: 10.1016/j.jmb.2024.168665. 10.1016/j.jmb.2024.168665 PubMed 38878854