pCMV-CIBN-STIM1(238-685)
(Plasmid
#248296)
-
PurposeAn expression construct encoding a CIBN-fused STIM1 fragment (a.a.238-685).
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 248296 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepCMV
-
Backbone manufacturerClontech
- Backbone size w/o insert (bp) 3953
- Total vector size (bp) 5831
-
Vector typeMammalian Expression
Growth in Bacteria
-
Bacterial Resistance(s)Kanamycin, 50 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)DH5alpha
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameCIBN-fused STIM1 fragment (a.a.238-685)
-
Alt nameSTIM1
-
SpeciesH. sapiens (human)
-
Insert Size (bp)1878
-
Mutationdeleted amino acids 1-237
-
Entrez GeneSTIM1 (a.k.a. D11S4896E, GOK, IMD10, STRMK, TAM, TAM1)
- Promoter CMV
-
Tag
/ Fusion Protein
- CIBN (N terminal on backbone)
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site Nhe1 (not destroyed)
- 3′ cloning site BsrG1 (not destroyed)
- 5′ sequencing primer CMV-F
- 3′ sequencing primer SV40-pAR
- (Common Sequencing Primers)
Resource Information
-
Supplemental Documents
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
CIBN
MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKAAKFDTETKDCNEAAKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYI
STIM1(238-685)
KEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pCMV-CIBN-STIM1(238-685) was a gift from Sangkyu Lee (Addgene plasmid # 248296 ; http://n2t.net/addgene:248296 ; RRID:Addgene_248296) -
For your References section:
AAV-compatible optogenetic tools for activating endogenous calcium channels in vivo. Kook YH, Lee H, Lee J, Jeong Y, Rho J, Heo WD, Lee S. Mol Brain. 2023 Oct 17;16(1):73. doi: 10.1186/s13041-023-01061-7. 10.1186/s13041-023-01061-7 PubMed 37848907