Skip to main content

pET21b-LOV-ipaA
(Plasmid #40236)

Full plasmid sequence is not available for this item.

Loading...

Ordering

This material is available to academics and nonprofits only.
Item Catalog # Description Quantity Price (USD)
Plasmid 40236 Standard format: Plasmid sent in bacteria as agar stab 1 $94

Backbone

  • Vector backbone
    pET-21b(+)
  • Backbone manufacturer
    EMD Biosciences
  • Backbone size w/o insert (bp) 5442
  • Total vector size (bp) 5939
  • Vector type
    Bacterial Expression

Growth in Bacteria

  • Bacterial Resistance(s)
    Ampicillin, 100 μg/mL
  • Growth Temperature
    37°C
  • Growth Strain(s)
    DH5alpha
  • Copy number
    High Copy

Gene/Insert

  • Gene/Insert name
    LOV-ipaA
  • Alt name
    Light-sensitive LOV2 domain of Avena Sativa phototropin 1(AsLov2)/Shigella invasin protein ipaA vinculin binding peptide chimera
  • Alt name
    AsLOV2 (aa 404-546)
  • Alt name
    ipaA (aa 610-631)
  • Species
    Synthetic; Avena sativa/Shigella flexneri
  • Insert Size (bp)
    497
  • Mutation
    Jα helix region hybridized (AsLOV2 aa 537-546/ipaA aa 610-619), residue 540 changed to isoleucine
  • GenBank ID
    AAC05083.1 AAP78988.1
  • Promoter T7
  • Tag / Fusion Protein
    • 6xHis (N terminal on insert)

Cloning Information

  • Cloning method Restriction Enzyme
  • 5′ cloning site NdeI (not destroyed)
  • 3′ cloning site XhoI (not destroyed)
  • 5′ sequencing primer T7 promoter
  • 3′ sequencing primer T7 terminator
  • (Common Sequencing Primers)

Terms and Licenses

  • Academic/Nonprofit Terms
  • Industry Terms
    • Not Available to Industry

Trademarks:

  • Zeocin® is an InvivoGen trademark.

Depositor Comments

This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide.

Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine.

The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector.

Protein coding sequence of LOV-ipaA:
MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN

How to cite this plasmid ( Back to top)

These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.

  • For your Materials & Methods section:

    pET21b-LOV-ipaA was a gift from Brian Kuhlman (Addgene plasmid # 40236 ; http://n2t.net/addgene:40236 ; RRID:Addgene_40236)
  • For your References section:

    Designing photoswitchable peptides using the AsLOV2 domain. Lungu OI, Hallett RA, Choi EJ, Aiken MJ, Hahn KM, Kuhlman B. Chem Biol. 2012 Apr 20;19(4):507-17. 10.1016/j.chembiol.2012.02.006 PubMed 22520757