pUC19 gene 60 thru gap + Cys
(Plasmid
#49161)
-
PurposeTemplate for generating gene 60 mRNA truncated two codons after coding gap + Cys
-
Depositing Lab
-
Sequence Information
Ordering
| Item | Catalog # | Description | Quantity | Price (USD) | |
|---|---|---|---|---|---|
| Plasmid | 49161 | Standard format: Plasmid sent in bacteria as agar stab | 1 | $89 | |
Backbone
-
Vector backbonepUC19
- Backbone size w/o insert (bp) 2662
- Total vector size (bp) 2986
Growth in Bacteria
-
Bacterial Resistance(s)Ampicillin, 100 μg/mL
-
Growth Temperature37°C
-
Growth Strain(s)JM109
-
Copy numberHigh Copy
Gene/Insert
-
Gene/Insert nameBacteriophage T4 gene 60
-
SpeciesEnterobacteria phage T4
-
Insert Size (bp)324
-
Mutationgene 60 mRNA truncated two codons after coding gap; Cysteine added as reporter for in vitro translation.
-
GenBank IDM19728.1
- Promoter T7
Cloning Information
- Cloning method Restriction Enzyme
- 5′ cloning site XbaI (not destroyed)
- 3′ cloning site HindIII (not destroyed)
- 5′ sequencing primer M13 fwd
- 3′ sequencing primer M13 rev (Common Sequencing Primers)
Terms and Licenses
-
Academic/Nonprofit Terms
-
Industry Terms
- Not Available to Industry
Trademarks:
- Zeocin® is an InvivoGen trademark.
Depositor Comments
This plasmid has a "coding gap," a unique feature of this gene that is similar to a programed ribosomal frame shift, but larger.
The gene60 mutant in this plasmid is composed of two discontinuous reading frames (corresponding to nts 77-214 and 265-76 of Addgene's sequencing result with M13pUC-Fwd primer), and the resulting protein sequence is MKFVKIDSSSVDMKKYKLQNNVRRSIKSSSMNYANVAIMTDADHDG^LGC*, where ^ indicates nts 215-64 that get skipped by the ribosome.
These plasmids were created by your colleagues. Please acknowledge the Principal Investigator, cite the article in which the plasmids were described, and include Addgene in the Materials and Methods of your future publications.
-
For your Materials & Methods section:
pUC19 gene 60 thru gap + Cys was a gift from Nils Walter (Addgene plasmid # 49161 ; http://n2t.net/addgene:49161 ; RRID:Addgene_49161) -
For your References section:
Secondary structure of bacteriophage T4 gene 60 mRNA: implications for translational bypassing. Todd GC, Walter NG. RNA. 2013 May;19(5):685-700. doi: 10.1261/rna.037291.112. Epub 2013 Mar 14. 10.1261/rna.037291.112 PubMed 23492219